Structure of PDB 5t61 Chain B

Receptor sequence

>5t61B (length=429) Species: 866790 (Methanothermobacter sp. CaT2)

MEYVKNVVCPFCGTLCDDIICKVEGNEIVGTINACRIGHSKFVHAEGAMR
YKKPLIRKNGEFVEVSYDEAIDKAAKILAESKRPLMYGWSCTECEAQAVG
VELAEEAGAVIDNTASVCHGPSVLALQDVGYPICTFGEVKNRADVVVYWG
CNPMHAHPRHMSRNVFARGFFRERGRSDRTLIVVDPRKTDSAKLADIHLQ
LDFDRDYELLDAMRACLLGHEILYDEVAGVPREQIEEAVEVLKNAQFGIL
FFGMGITHSRGKHRNIDTAIMMVQDLNDYAKWTLIPMRGHYNVTGFNQVC
TWESGYPYCVDFSGGEPRYNPGETGANDLLQNREADAMMVIASDPGAHFP
QRALERMAEIPVIAIEPHRTPTTEMADIIIPPAIVGMEAEGTAYRMEGVP
IRMKKVVDSDLLSDREILERLLEKVREYK

3D structure

• PDB: 5t61 The methanogenic CO2 reducing-and-fixing enzyme is bifunctional and contains 46 [4Fe-4S] clusters.
• Chain: B
• Resolution: 2.55 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	B	C9 C12 T14 C16 C35 R159	C9 C12 T14 C16 C35 R159
BS02	MGD	B	K41 C91 T114 V117 C118 H258 H290 A342 S343 D344 H348 E366 P367 P382 I384 V385 D414	K41 C91 T114 V117 C118 H258 H290 A342 S343 D344 H348 E366 P367 P382 I384 V385 D414
BS03	MGD	B	F11 I37 G150 C151 H155 A156 D185 P186 R187 F203 D204 D206 G253 M254 G255 S259 G289 H290	F11 I37 G150 C151 H155 A156 D185 P186 R187 F203 D204 D206 G253 M254 G255 S259 G289 H290

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Nov 26 06:31:13 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5t61', asym_id = 'B', title = 'The methanogenic CO2 reducing-and-fixing enzyme is bifunctional and contains 46 [4Fe-4S] clusters.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5t61', asym_id='B', title='The methanogenic CO2 reducing-and-fixing enzyme is bifunctional and contains 46 [4Fe-4S] clusters.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0015948,0016491,0018493', uniprot = '', pdbid = '5t61', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015948,0016491,0018493', uniprot='', pdbid='5t61', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>