Structure of PDB 5t5i Chain B

Receptor sequence

>5t5iB (length=430) Species: 866790 (Methanothermobacter sp. CaT2)

MEYVKNVVCPFCGTLCDDIICKVEGNEIVGTINACRIGHSKFVHAEGAMR
YKKPLIRKNGEFVEVSYDEAIDKAAKILAESKRPLMYGWSCTECEAQAVG
VELAEEAGAVIDNTASVCHGPSVLALQDVGYPICTFGEVKNRADVVVYWG
CNPMHAHPRHMSRNVFARGFFRERGRSDRTLIVVDPRKTDSAKLADIHLQ
LDFDRDYELLDAMRACLLGHEILYDEVAGVPREQIEEAVEVLKNAQFGIL
FFGMGITHSRGKHRNIDTAIMMVQDLNDYAKWTLIPMRGHYNVTGFNQVC
TWESGYPYCVDFSGGEPRYNPGETGANDLLQNREADAMMVIASDPGAHFP
QRALERMAEIPVIAIEPHRTPTTEMADIIIPPAIVGMEAEGTAYRMEGVP
IRMKKVVDSDLLSDREILERLLEKVREYKA

3D structure

• PDB: 5t5i The methanogenic CO2 reducing-and-fixing enzyme is bifunctional and contains 46 [4Fe-4S] clusters.
• Chain: B
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): I37 C118 H119 R288
• Catalytic site (residue number reindexed from 1): I37 C118 H119 R288

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	B	C9 F11 C12 L15 C16 C35 P158 R159	C9 F11 C12 L15 C16 C35 P158 R159
BS02	MGD	B	K41 C91 T114 V117 C118 H258 H290 A342 S343 D344 H348 E366 P367 P382 I384 V385 D414	K41 C91 T114 V117 C118 H258 H290 A342 S343 D344 H348 E366 P367 P382 I384 V385 D414
BS03	MGD	B	F11 I37 G150 C151 A156 D185 P186 R187 D206 G253 M254 G255 G289 H290	F11 I37 G150 C151 A156 D185 P186 R187 D206 G253 M254 G255 G289 H290

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0018493 formylmethanofuran dehydrogenase activity
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0015948 methanogenesis

External links

• PDB: RCSB:5t5i, PDBe:5t5i, PDBj:5t5i
• PDBsum: 5t5i
• PubMed: 27846502
• UniProt: T2GJQ6