Structure of PDB 5t07 Chain B

Receptor sequence

>5t07B (length=130) Species: 83334 (Escherichia coli O157:H7)

TLFRWPVRVYYEDTAAGGVVYHASYVAFYERARTEMLRHHHFSQQALMAE
RVAFVVRKMTVEYYAPARLDDMLEIQTEITSMRGTSLVFTQRIVNAENTL
LNEAEVLVVCVDPLKMKPRALPKSIVAEFK

3D structure

• PDB: 5t07 Crystal structure of a putative acyl-CoA thioesterase EC709/ECK0725 from Escherichia coli in complex with Decanoyl-CoA
• Chain: B
• Resolution: 1.717 Å

Enzymatic activity

• Enzyme Commision number: 3.1.2.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MFK	B	Y24 H25 Y66 Y67 A68	Y21 H22 Y63 Y64 A65

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0016787 hydrolase activity
• GO:0016790 thiolester hydrolase activity
• GO:0047617 fatty acyl-CoA hydrolase activity

Biological Process

• GO:0006629 lipid metabolic process

Cellular Component

• GO:0005886 plasma membrane

External links

• PDB: RCSB:5t07, PDBe:5t07, PDBj:5t07
• PDBsum: 5t07
• UniProt: P0A8Z3|YBGC_ECOLI Acyl-CoA thioester hydrolase YbgC (Gene Name=ybgC)