Structure of PDB 5svm Chain B

Receptor sequence

>5svmB (length=320) Species: 9606 (Homo sapiens) [Search protein sequence]

INRVVQLLIISYFVGWVFLHEKAYQVRDTAIESSVVTKVKGSGLYANRVM
DVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDSQCGPE
RLPGGGILTGRCVNYSSVLRTCEIQGWCPTEVDTVETPIMMEAENFTIFI
KNSIRFPLFNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFA
GQDFAKLARTGGVLGIKIGWVCDLDKAWDQCIPKYSFTRLDSVSEKSSVS
PGYNFRFAKYYKMENGSEYRTLLKAFGIRFDVLVYGNAGKFNIIPTIISS
VAAFTSVGVGTVLCDIILLN

3D structure

PDB

5svm X-ray structures define human P2X3 receptor gating cycle and antagonist action.

Chain

Resolution

3.093 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	B	V274 S275 N279 R281 K299	V249 S250 N254 R256 K274

Gene Ontology

	Molecular Function
GO:0001614	purinergic nucleotide receptor activity
GO:0004931	extracellularly ATP-gated monoatomic cation channel activity
GO:0005216	monoatomic ion channel activity
GO:0005524	ATP binding
GO:0015267	channel activity

	Biological Process
GO:0001666	response to hypoxia
GO:0006811	monoatomic ion transport
GO:0006812	monoatomic cation transport
GO:0007165	signal transduction
GO:0007268	chemical synaptic transmission
GO:0007274	neuromuscular synaptic transmission
GO:0009266	response to temperature stimulus
GO:0009408	response to heat
GO:0009409	response to cold
GO:0009612	response to mechanical stimulus
GO:0009743	response to carbohydrate
GO:0010524	positive regulation of calcium ion transport into cytosol
GO:0014832	urinary bladder smooth muscle contraction
GO:0030432	peristalsis
GO:0033198	response to ATP
GO:0034220	monoatomic ion transmembrane transport
GO:0035590	purinergic nucleotide receptor signaling pathway
GO:0048167	regulation of synaptic plasticity
GO:0048266	behavioral response to pain
GO:0050804	modulation of chemical synaptic transmission
GO:0050850	positive regulation of calcium-mediated signaling
GO:0050909	sensory perception of taste
GO:0051649	establishment of localization in cell
GO:0060079	excitatory postsynaptic potential
GO:0070207	protein homotrimerization
GO:0070588	calcium ion transmembrane transport
GO:0071318	cellular response to ATP
GO:0098655	monoatomic cation transmembrane transport
GO:0098662	inorganic cation transmembrane transport

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0030424	axon
GO:0043005	neuron projection
GO:0043235	receptor complex
GO:0098685	Schaffer collateral - CA1 synapse
GO:0098686	hippocampal mossy fiber to CA3 synapse
GO:0098794	postsynapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5svm, PDBe:5svm, PDBj:5svm
PDBsum	5svm
PubMed	27626375
UniProt	P56373\|P2RX3_HUMAN P2X purinoceptor 3 (Gene Name=P2RX3)

[Back to BioLiP]