Structure of PDB 5s56 Chain B

Receptor sequence

>5s56B (length=425) Species: 9913 (Bos taurus)

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVY
YNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNN
WAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTL
LISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETY
CIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADL
RKLAVNMVPFPRLHFFMPGFAPLTSRQQYRALTVPELTQQMFDSKNMMAA
CDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTA
VCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEG
MDEMEFTEAESNMNDLVSEYQQYQD

3D structure

• PDB: 5s56 Comprehensive Analysis of Binding Sites in Tubulin.
• Chain: B
• Resolution: 2.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GDP	B	G10 Q11 C12 S140 G143 G144 T145 G146 D179 E183 N206 Y224 N228	G10 Q11 C12 S138 G141 G142 T143 G144 D177 E181 N204 Y222 N226
BS02	O3G	B	R158 Y161 P162 D163 R164 I165 M166 N197 D199 R253	R156 Y159 P160 D161 R162 I163 M164 N195 D197 R251
BS03	O3G	B	V177 P222 Y224	V175 P220 Y222

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005200 structural constituent of cytoskeleton
• GO:0005525 GTP binding
• GO:0046872 metal ion binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0000226 microtubule cytoskeleton organization
• GO:0000278 mitotic cell cycle
• GO:0007017 microtubule-based process
• GO:0007399 nervous system development
• GO:1902669 positive regulation of axon guidance

Cellular Component

• GO:0005737 cytoplasm
• GO:0005856 cytoskeleton
• GO:0005874 microtubule
• GO:0015630 microtubule cytoskeleton

External links

• PDB: RCSB:5s56, PDBe:5s56, PDBj:5s56
• PDBsum: 5s56
• PubMed: 33951246
• UniProt: Q6B856|TBB2B_BOVIN Tubulin beta-2B chain (Gene Name=TUBB2B)