Structure of PDB 5ond Chain B

Receptor sequence
>5ondB (length=133) Species: 562 (Escherichia coli) [Search protein sequence]
MQSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRGKRTAVSEPL
FPNYLFVEFDPEVIHTTTINATRGVSHFVRFGASPAIVPSAVIHQLSVTE
GAFEGFQAIFTEPDGEARSMLLLNLINKEIKHS
3D structure
PDB5ond The universally-conserved transcription factor RfaH is recruited to a hairpin structure of the non-template DNA strand.
ChainB
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B K10 H20 R23 Q24 T68 N70 A71 T72 R73 G74 V75 K10 H20 R23 Q24 T68 N70 A71 T72 R73 G74 V75
Gene Ontology
Molecular Function
GO:0001000 bacterial-type RNA polymerase core enzyme binding
GO:0001073 transcription antitermination factor activity, DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008494 translation activator activity
GO:0061980 regulatory RNA binding
Biological Process
GO:0006354 DNA-templated transcription elongation
GO:0006355 regulation of DNA-templated transcription
GO:0031564 transcription antitermination
GO:0045727 positive regulation of translation
GO:0140673 transcription elongation-coupled chromatin remodeling
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ond, PDBe:5ond, PDBj:5ond
PDBsum5ond
PubMed29741479
UniProtP0AFW0|RFAH_ECOLI Transcription antitermination protein RfaH (Gene Name=rfaH)

[Back to BioLiP]