Structure of PDB 5om7 Chain B

Receptor sequence

>5om7B (length=33) Species: 9606 (Homo sapiens)

RTIVRFNRPFLMIIVDNFTWSIFFMSKVTNPKQ

3D structure

• PDB: 5om7 Design of an allosterically modulated doxycycline and doxorubicin drug-binding protein.
• Chain: B
• Resolution: 1.727 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DM2	B	V381 N383 W386	V15 N17 W20	PDBbind-CN: -logKd/Ki=5.74,Kd=1.8uM

External links

• PDB: RCSB:5om7, PDBe:5om7, PDBj:5om7
• PDBsum: 5om7
• PubMed: 29760101
• UniProt: P01011|AACT_HUMAN Alpha-1-antichymotrypsin (Gene Name=SERPINA3)