Structure of PDB 5o6j Chain B

Receptor sequence

>5o6jB (length=383) Species: 9606 (Homo sapiens)

KRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDL
GDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCG
VRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVL
IREITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSH
LSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLTRYLKQFHLT
PVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMNHPTH
KSLKAAYSFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLE
KLKFGIGDGNLQYYLYNWKCPSMGAEKVGLVLQ

3D structure

• PDB: 5o6j Fragment-derived inhibitors of human N-myristoyltransferase block capsid assembly and replication of the common cold virus.
• Chain: B
• Resolution: 1.45 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MYA	B	K114 Y117 Q118 F119 W120 Y180 V181 I245 L248 C249 V250 R255 S256 R258 A260 P261 T268 F277 A279 Y281 T282 L287 Y479	K1 Y4 Q5 F6 W7 Y67 V68 I132 L135 C136 V137 R142 S143 R145 A147 P148 T155 F164 A166 Y168 T169 L174 Y366
BS02	MG	B	L254 K257 V259	L141 K144 V146
BS03	9M8	B	V181 E182 D183 F188 R189 F190 T282 Y296 H298 S405 Y420 N451 A452 L453 Q496	V68 E69 D70 F75 R76 F77 T169 Y183 H185 S292 Y307 N338 A339 L340 Q383	MOAD: ic50=4.6nM

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity

Biological Process

• GO:0006499 N-terminal protein myristoylation

External links

• PDB: RCSB:5o6j, PDBe:5o6j, PDBj:5o6j
• PDBsum: 5o6j
• PubMed: 29760414
• UniProt: P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 (Gene Name=NMT1)