Structure of PDB 5o6h Chain B

Receptor sequence

>5o6hB (length=382) Species: 9606 (Homo sapiens)

RSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDLG
DRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGV
RVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLI
REITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHL
SRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLTRYLKQFHLTP
VMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMNHPTHK
SLKAAYSFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLEK
LKFGIGDGNLQYYLYNWKCPSMGAEKVGLVLQ

3D structure

• PDB: 5o6h Fragment-derived inhibitors of human N-myristoyltransferase block capsid assembly and replication of the common cold virus.
• Chain: B
• Resolution: 1.29 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MYA	B	Y117 Q118 F119 W120 Y180 V181 I245 L248 C249 V250 R255 S256 R258 A260 P261 T268 F277 A279 Y281 T282 L287 Y479	Y3 Q4 F5 W6 Y66 V67 I131 L134 C135 V136 R141 S142 R144 A146 P147 T154 F163 A165 Y167 T168 L173 Y365
BS02	9M2	B	V181 D183 F190 T282 Y296 Y420 N451 A452 L453 Q496	V67 D69 F76 T168 Y182 Y306 N337 A338 L339 Q382	MOAD: ic50=0.013uM
BS03	MG	B	L254 K257 V259	L140 K143 V145

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity

Biological Process

• GO:0006499 N-terminal protein myristoylation

External links

• PDB: RCSB:5o6h, PDBe:5o6h, PDBj:5o6h
• PDBsum: 5o6h
• PubMed: 29760414
• UniProt: P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 (Gene Name=NMT1)