Structure of PDB 5nui Chain B |
>5nuiB (length=130) Species: 11723 (Simian immunodeficiency virus) [Search protein sequence] |
PKVPLRTMSYKLAIDMSHFIKEKGGLEGIYYSARRHRILDIYLEKEEGII PDWQDYTSGPGIRYPKTFGWLWKLVPVNVSDEAQEDEEHYLMHPAQTSQW DDPWGEVLAWKFDPTLAYTYEAYVRYPEEF |
|
PDB | 5nui Endocytic sorting motif interactions involved in Nef-mediated downmodulation of CD4 and CD3. |
Chain | B |
Resolution | 2.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
K126 R138 |
K23 R35 |
|
|
|
|