Structure of PDB 5ns4 Chain B

Receptor sequence

>5ns4B (length=146) Species: 274 (Thermus thermophilus)

VALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLRILEKAAQELA
LITGQKPAVTRAKKGMPIGLRVTLRRDRMWIFLEKLLNVALPRIRFRGLN
PNSFDGRGNYNLGLREQLGMDIAVVTTAETDEEARALLELLGFPFR

3D structure

• PDB: 5ns4 Crystal Structures of Cyanine Fluorophores Stacked onto the End of Double-Stranded RNA.
• Chain: B
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	Q66 K67 A69 V92 T93 R95 R96 R98	Q55 K56 A58 V72 T73 R75 R76 R78
BS02	rna	B	K36 V38 N40 T71 K74 I88 R91 S124 F125 D126 R128 N132 L133 G134 D156 A158	K32 V34 N36 T60 K63 I68 R71 S103 F104 D105 R107 N111 L112 G113 D121 A123
BS03	MG	B	R128 G129 N130 T161 A163	R107 G108 N109 T126 A128

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5ns4, PDBe:5ns4, PDBj:5ns4
• PDBsum: 5ns4
• PubMed: 29211987
• UniProt: P41201|RL5_THETH Large ribosomal subunit protein uL5 (Gene Name=rplE)