Structure of PDB 5ns3 Chain B

Receptor sequence
>5ns3B (length=138) Species: 274 (Thermus thermophilus) [Search protein sequence]
VALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINILEKAAQELALITG
QKPAVTRAKKGMPIGLRVTLRRDRMWIFLEKLLNVALPRIRFRGLNPNSF
DGRGNYNLGLGMDIAVVTTAETDEEARALLELLGFPFR
3D structure
PDB5ns3 Crystal Structures of Cyanine Fluorophores Stacked onto the End of Double-Stranded RNA.
ChainB
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B Q66 K67 A69 R91 V92 T93 R95 R96 R98 Q51 K52 A54 R67 V68 T69 R71 R72 R74
BS02 rna B K36 V38 N40 T71 I88 R91 S124 D126 R128 N130 N132 D156 K32 V34 N36 T56 I64 R67 S99 D101 R103 N105 N107 D113
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ns3, PDBe:5ns3, PDBj:5ns3
PDBsum5ns3
PubMed29211987
UniProtP41201|RL5_THETH Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]