Structure of PDB 5n62 Chain B |
>5n62B (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] |
CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA LLSPYSYSTTAVVTNP |
|
PDB | 5n62 Copper mediated amyloid-beta binding to Transthyretin. |
Chain | B |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
B |
E66 N98 |
E57 N89 |
|
|
|
|