Structure of PDB 5mu6 Chain B

Receptor sequence

>5mu6B (length=377) Species: 9606 (Homo sapiens)

RSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDLG
DRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGV
RVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLI
REITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHL
SRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLTRYLKQFHLTP
VMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMKSLKAA
YSFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLEKLKFGI
GDGNLQYYLYNWKCPSMGAEKVGLVLQ

3D structure

• PDB: 5mu6 Fragment-derived inhibitors of human N-myristoyltransferase block capsid assembly and replication of the common cold virus.
• Chain: B
• Resolution: 1.88 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MYA	B	Y117 Q118 F119 W120 Y180 V181 I245 L248 V250 R255 S256 R258 A260 A279 Y281 T282 L287 Y479	Y3 Q4 F5 W6 Y66 V67 I131 L134 V136 R141 S142 R144 A146 A165 Y167 T168 L173 Y360
BS02	MG	B	L254 R255 K257 V259	L140 R141 K143 V145
BS03	KFK	B	V181 F188 R189 F190 T282 Y296 S405 Y420 N451 A452 Q496	V67 F74 R75 F76 T168 Y182 S291 Y301 N332 A333 Q377	MOAD: Kd<210pM BindingDB: IC50=<1.000000nM

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity

Biological Process

• GO:0006499 N-terminal protein myristoylation

External links

• PDB: RCSB:5mu6, PDBe:5mu6, PDBj:5mu6
• PDBsum: 5mu6
• PubMed: 29760414
• UniProt: P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 (Gene Name=NMT1)