Structure of PDB 5mte Chain B

Receptor sequence

>5mteB (length=137) Species: 238892 (Vibrio phage VP16T)

MKILKDDAPELHAIAAEVPHGEDVKDLVLDMTAAMTAAGGIGLAGNQVGV
LKRIIVLRCPTFKGCVINPIITRHTDGHVYSPEGCLSYPGKTVAKKRRNK
VVVEGYDMDWQPITIAAKGLTAFCLQHEIDHLNGVTI

3D structure

• PDB: 5mte Peptide deformylases from Vibrio parahaemolyticus phage and bacteria display similar deformylase activity and inhibitor binding clefts.
• Chain: B
• Resolution: 1.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G42 Q47 C85 L86 H127 E128 H131
• Catalytic site (residue number reindexed from 1): G42 Q47 C85 L86 H127 E128 H131

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BB2	B	G40 I41 G42 Q47 P82 E83 G84 C85 L86 L120 H127 E128 H131	G40 I41 G42 Q47 P82 E83 G84 C85 L86 L120 H127 E128 H131
BS02	ZN	B	C85 H127 H131	C85 H127 H131

Gene Ontology

Molecular Function

• GO:0042586 peptide deformylase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0018206 peptidyl-methionine modification

External links

• PDB: RCSB:5mte, PDBe:5mte, PDBj:5mte
• PDBsum: 5mte
• PubMed: 29101077
• UniProt: Q6VT21