Structure of PDB 5msm Chain B

Receptor sequence

>5msmB (length=132) Species: 559292 (Saccharomyces cerevisiae S288C)

PSVDIDASQWQKLTQSREKQTTVITPLGMMMLEIQGELELPKDFASLARR
DSPNEGRFSEQDGETLIRFGSLQIDGERATLFVGKKQRLLGKVTKLDVPM
GIMHFNSKDNKVELVDVMKYKVIFKDRPLPIM

3D structure

• PDB: 5msm Structural studies of RFC(C)(tf18) reveal a novel chromatin recruitment role for Dcc1.
• Chain: B
• Resolution: 2.29 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	P2 V4 Q36 G37 E38 E40 R51 V84 G85 K86 Q88 F106 N107 S108 N111 K112 K126 D127 R128 P129	P1 V3 Q35 G36 E37 E39 R50 V83 G84 K85 Q87 F105 N106 S107 N110 K111 K125 D126 R127 P128
BS02	peptide	B	D63 G64 E65 T66 S108 K109 N111	D62 G63 E64 T65 S107 K108 N110

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003677 DNA binding
• GO:0005515 protein binding

Biological Process

• GO:0006260 DNA replication
• GO:0007064 mitotic sister chromatid cohesion
• GO:0034398 telomere tethering at nuclear periphery
• GO:0035753 maintenance of DNA trinucleotide repeats

Cellular Component

• GO:0005634 nucleus
• GO:0031390 Ctf18 RFC-like complex

External links

• PDB: RCSB:5msm, PDBe:5msm, PDBj:5msm
• PDBsum: 5msm
• PubMed: 28188145
• UniProt: P38877|CTF8_YEAST Chromosome transmission fidelity protein 8 (Gene Name=CTF8)