Structure of PDB 5mrf Chain B

Receptor sequence

>5mrfB (length=321) Species: 4932 (Saccharomyces cerevisiae)

LKIIPNDTDIVTLEKQDELIKRRRKLSKEVTQMKRLKPVSPGLRWYRSPI
YPYLYKGRPVRALTVVRKKHGGRNNSGKITVRHQGGGHRNRTRLIDFNRW
EGGAQTVQRIEYDPGRSSHIALLKHNTTGELSYIIACDGLRPGDVVESFR
RGIPQTLLNEAILSVKTTQRGNCLPISMIPIGTIIHNVGITPVGPGKFCR
SAGTYARVLAKLPEKKKAIVRLQSGEHRYVSLEAVATIGVVSNIDHQNRS
LGKAGRSRWLGIRPTVRGVAMNKCDHPHGGGRGKSKSNKLSMSPWGQLAK
GYKTRRGKNQNRMKVKDRPRG

3D structure

• PDB: 5mrf The structure of the yeast mitochondrial ribosome.
• Chain: B
• Resolution: 4.97 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	K94 R95 K97 P98 V99 S100 P101 G102 L103 R104 W105 K116 R118 R121 V126 R127 K128 K129 H130 G132 R133 N134 N135 S136 G137 K138 I139 T140 V141 R142 H143 Q144 G145 G146 H148 R149 N150 R151 R153 Y172 P174 G175 R176 P259 K264 F265 C266 R267 S268 A269 G270 K282 L289 Q290 S291 R295 I311 H313 Q314 S317 L318 K320 A321 G322 R323 S324 R325 W326 R330 P331 T332 V333 R334 G335 V336 A337 M338 N339 K340 C341 D342 H343 H345 G348 R349 G350 K351 K353 S354 N355 K356 L357 S358 M359 S360 P361 W362 Q364 A366 K367 G368 Y369 K370 T371 R372 R373 K375 N378 R379 R385 R387	K34 R35 K37 P38 V39 S40 P41 G42 L43 R44 W45 K56 R58 R61 V66 R67 K68 K69 H70 G72 R73 N74 N75 S76 G77 K78 I79 T80 V81 R82 H83 Q84 G85 G86 H88 R89 N90 R91 R93 Y112 P114 G115 R116 P192 K197 F198 C199 R200 S201 A202 G203 K215 L222 Q223 S224 R228 I244 H246 Q247 S250 L251 K253 A254 G255 R256 S257 R258 W259 R263 P264 T265 V266 R267 G268 V269 A270 M271 N272 K273 C274 D275 H276 H278 G281 R282 G283 K284 K286 S287 N288 K289 L290 S291 M292 S293 P294 W295 Q297 A299 K300 G301 Y302 K303 T304 R305 R306 K308 N311 R312 R318 R320
BS02	rna	B	R84 K88	R24 K28
BS03	MG	B	R334 K351	R267 K284

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0016740 transferase activity

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5mrf, PDBe:5mrf, PDBj:5mrf
• PDBsum: 5mrf
• PubMed: 28154081
• UniProt: P32611|RML2_YEAST Large ribosomal subunit protein uL2m (Gene Name=RML2)