Structure of PDB 5mqj Chain B

Receptor sequence
>5mqjB (length=228) Species: 9606 (Homo sapiens) [Search protein sequence]
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSTGGNVL
QMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYS
DRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATP
ETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVP
ILTLDVNEDFKDKYESLVEKVKEFLSTL
3D structure
PDB5mqj Dual protein kinase and nucleoside kinase modulators for rationally designed polypharmacology.
ChainB
Resolution3.7 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E53 R128
Catalytic site (residue number reindexed from 1) E34 R96
Enzyme Commision number 2.7.1.113: deoxyguanosine kinase.
2.7.1.74: deoxycytidine kinase.
2.7.1.76: deoxyadenosine kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 UDP B A31 G33 K34 S35 T36 R188 L191 R192 D241 F242 K243 A12 G14 K15 S16 T17 R156 L159 R160 D209 F210 K211
BS02 UMP B I30 E53 W58 L82 Y86 F96 Q97 R128 D133 F137 R192 R194 E197 I11 E34 W39 L50 Y54 F64 Q65 R96 D101 F105 R160 R162 E165
BS03 MG B E53 E127 E34 E95
Gene Ontology
Molecular Function
GO:0004136 deoxyadenosine kinase activity
GO:0004137 deoxycytidine kinase activity
GO:0004138 deoxyguanosine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0019136 deoxynucleoside kinase activity
GO:0042803 protein homodimerization activity
GO:0043771 cytidine kinase activity
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0006220 pyrimidine nucleotide metabolic process
GO:0009224 CMP biosynthetic process
GO:0016310 phosphorylation
GO:0106383 dAMP salvage
GO:1901135 carbohydrate derivative metabolic process
GO:1901293 nucleoside phosphate biosynthetic process
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mqj, PDBe:5mqj, PDBj:5mqj
PDBsum5mqj
PubMed29127277
UniProtP27707|DCK_HUMAN Deoxycytidine kinase (Gene Name=DCK)

[Back to BioLiP]