Structure of PDB 5ml2 Chain B

Receptor sequence
>5ml2B (length=144) Species: 9606 (Homo sapiens) [Search protein sequence]
SAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPK
KILKCKAVSRELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNS
TNTWQSLIEAMMPASVLTGNVIIETKFFDDDLLVSTSRVRLFYV
3D structure
PDB5ml2 A PDE6 delta-KRas Inhibitor Chemotype with up to Seven H-Bonds and Picomolar Affinity that Prevents Efficient Inhibitor Release by Arl2.
ChainB
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NH6 B M20 L22 W32 I53 R61 Q78 V80 W90 M117 I129 T131 F133 L147 Y149 M19 L21 W31 I52 R60 Q77 V79 W89 M111 I123 T125 F127 L141 Y143 MOAD: Kd=13nM
PDBbind-CN: -logKd/Ki=7.89,Kd=13nM
BindingDB: Kd=65nM
Gene Ontology
Molecular Function
GO:0005095 GTPase inhibitor activity
GO:0005515 protein binding
GO:0031267 small GTPase binding
Biological Process
GO:0007601 visual perception
GO:0050953 sensory perception of light stimulus
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005929 cilium
GO:0016020 membrane
GO:0030659 cytoplasmic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0042995 cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ml2, PDBe:5ml2, PDBj:5ml2
PDBsum5ml2
PubMed28106325
UniProtO43924|PDE6D_HUMAN Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta (Gene Name=PDE6D)

[Back to BioLiP]