Structure of PDB 5m7k Chain B

Receptor sequence

>5m7kB (length=273) Species: 1079 (Blastochloris viridis)

ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIG
YAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISW
MLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGI
LSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANP
GDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIA
SGPFWTRGWPEWWGWWLDIPFWS

3D structure

• PDB: 5m7k Asymmetry in serial femtosecond crystallography data.
• Chain: B
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	B	M174 V177 S178 F181 M185	M174 V177 S178 F181 M185
BS02	BCL	B	F97 P124 M127 V157 F160 Y162 W167 H168 H173 S176 V177 F181 F241 G244 T248	F97 P124 M127 V157 F160 Y162 W167 H168 H173 S176 V177 F181 F241 G244 T248
BS03	BCL	B	F128 F146 H153 L154	F128 F146 H153 L154
BS04	BPB	B	I42 I49 W100 F121 P124 Y148 G149 I150 H153 F241	I42 I49 W100 F121 P124 Y148 G149 I150 H153 F241
BS05	MPG	B	W115 H116 L119 S238	W115 H116 L119 S238
BS06	MPG	B	H190 F216 I229	H190 F216 I229
BS07	BPB	B	F181 M185 L189	F181 M185 L189
BS08	FE2	B	H190 H230	H190 H230
BS09	MQ7	B	Y29 R103	Y29 R103

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:5m7k, PDBe:5m7k, PDBj:5m7k
• PDBsum: 5m7k
• PubMed: 28248658
• UniProt: P06009|RCEL_BLAVI Reaction center protein L chain (Gene Name=pufL)