Structure of PDB 5m7j Chain B

Receptor sequence

>5m7jB (length=273) Species: 1079 (Blastochloris viridis)

ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIG
YAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISW
MLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGI
LSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANP
GDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIA
SGPFWTRGWPEWWGWWLDIPFWS

3D structure

• PDB: 5m7j Asymmetry in serial femtosecond crystallography data.
• Chain: B
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	B	M174 V177 S178 F181 M185	M174 V177 S178 F181 M185
BS02	BCL	B	F97 P124 M127 V157 F160 W167 H168 H173 S176 V177 F181 G244 T248	F97 P124 M127 V157 F160 W167 H168 H173 S176 V177 F181 G244 T248
BS03	BCL	B	F128 F146 H153 L154	F128 F146 H153 L154
BS04	BPB	B	I42 I49 W100 E104 F121 P124 Y148 G149 H153 F241	I42 I49 W100 E104 F121 P124 Y148 G149 H153 F241
BS05	MPG	B	W115 H116 L119 S238	W115 H116 L119 S238
BS06	MPG	B	H190 F216 I229	H190 F216 I229
BS07	FE2	B	H190 H230	H190 H230
BS08	BPB	B	F181 M185 L189	F181 M185 L189
BS09	MQ7	B	Y29 I39 R103	Y29 I39 R103

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:5m7j, PDBe:5m7j, PDBj:5m7j
• PDBsum: 5m7j
• PubMed: 28248658
• UniProt: P06009|RCEL_BLAVI Reaction center protein L chain (Gene Name=pufL)