Structure of PDB 5m2o Chain B

Receptor sequence
>5m2oB (length=74) Species: 641112 (Ruminococcus flavefaciens FD-1) [Search protein sequence]
SVQKFPGDANCDGIVDISDAVLIMQTMANPSKYQMTDKGRINADVTGNSD
GVTVLDAQFIQSYCLGLVELPPVE
3D structure
PDB5m2o Assembly of Ruminococcus flavefaciens cellulosome revealed by structures of two cohesin-dockerin complexes.
ChainB
Resolution1.26 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CA B D30 N32 D34 I36 D41 D8 N10 D12 I14 D19
BS02 CA B D66 T68 D72 G73 D78 D44 T46 D50 G51 D56
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Mon Nov 18 04:42:53 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5m2o', asym_id = 'B', title = 'Assembly of Ruminococcus flavefaciens cellulosom... by structures of two cohesin-dockerin complexes.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5m2o', asym_id='B', title='Assembly of Ruminococcus flavefaciens cellulosom... by structures of two cohesin-dockerin complexes.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0000272,0004553', uniprot = '', pdbid = '5m2o', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000272,0004553', uniprot='', pdbid='5m2o', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>