Structure of PDB 5lzg Chain B

Receptor sequence

>5lzgB (length=103) Species: 243277 (Vibrio cholerae O1 biovar El Tor str. N16961)

TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQV
EVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAIS
MAN

3D structure

• PDB: 5lzg Towards new cholera prophylactics and treatment: Crystal structures of bacterial enterotoxins in complex with GM1 mimics.
• Chain: B
• Resolution: 1.13 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	7BN	B	G33 K34	G33 K34	PDBbind-CN: -logKd/Ki=3.10,IC50~0.8mM
BS02	7BN	B	E11 Y12 H13 E51 H57 Q61 W88 N90 K91	E11 Y12 H13 E51 H57 Q61 W88 N90 K91	PDBbind-CN: -logKd/Ki=3.10,IC50~0.8mM

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0005534 galactose binding
• GO:0046812 host cell surface binding
• GO:0090729 toxin activity

Biological Process

• GO:0035821 modulation of process of another organism
• GO:0042531 positive regulation of tyrosine phosphorylation of STAT protein

Cellular Component

• GO:0005576 extracellular region
• GO:0016020 membrane
• GO:0020002 host cell plasma membrane
• GO:0042597 periplasmic space
• GO:1902494 catalytic complex

External links

• PDB: RCSB:5lzg, PDBe:5lzg, PDBj:5lzg
• PDBsum: 5lzg
• PubMed: 28539625
• UniProt: P01556|CHTB_VIBCH Cholera enterotoxin subunit B (Gene Name=ctxB)