Structure of PDB 5lxh Chain B

Receptor sequence

>5lxhB (length=115) Species: 9606 (Homo sapiens) [Search protein sequence]

MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL
VPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHE
EDYFLYVAYSDESVY

3D structure

PDB

5lxh ATG4B contains a C-terminal LIR motif important for binding and efficient cleavage of mammalian orthologs of yeast Atg8.

Chain

Resolution

1.58 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	E17 K20 I21 K24 Y25 R28 I32 K46 K48 Y49 L50 R67 F104	E17 K20 I21 K24 Y25 R28 I32 K46 K48 Y49 L50 R67 F104

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0005543	phospholipid binding
GO:0008429	phosphatidylethanolamine binding
GO:0030957	Tat protein binding
GO:0031625	ubiquitin protein ligase binding
GO:0048487	beta-tubulin binding
GO:0050811	GABA receptor binding

	Biological Process
GO:0000045	autophagosome assembly
GO:0000422	autophagy of mitochondrion
GO:0006914	autophagy
GO:0006995	cellular response to nitrogen starvation
GO:0061723	glycophagy
GO:0097352	autophagosome maturation

	Cellular Component
GO:0000421	autophagosome membrane
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005776	autophagosome
GO:0005783	endoplasmic reticulum
GO:0005794	Golgi apparatus
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005874	microtubule
GO:0016020	membrane
GO:0030659	cytoplasmic vesicle membrane
GO:0031410	cytoplasmic vesicle

External links

PDB	RCSB:5lxh, PDBe:5lxh, PDBj:5lxh
PDBsum	5lxh
PubMed	28287329
UniProt	Q9H0R8\|GBRL1_HUMAN Gamma-aminobutyric acid receptor-associated protein-like 1 (Gene Name=GABARAPL1)