Structure of PDB 5lih Chain B

Receptor sequence

>5lihB (length=320) Species: 9606 (Homo sapiens)

LGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVQTEKHVFE
QASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARF
YSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPG
DTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDTED
YLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQG
HPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLTPDDD
DIVRKIDQSEFEGFEYINPL

3D structure

• PDB: 5lih aPKC Inhibition by Par3 CR3 Flanking Regions Controls Substrate Access and Underpins Apical-Junctional Polarization.
• Chain: B
• Resolution: 3.25 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D378 K380 N383 D396 T416
• Catalytic site (residue number reindexed from 1): D121 K123 N126 D139 T159
• Enzyme Commision number: 2.7.11.13: protein kinase C.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	S264 Y265 D339 M341 M344 Q345 M399 F413 C414 G415 P417 E445 G449 R450	S16 Y17 D82 M84 M87 Q88 M142 F156 C157 G158 P160 E188 G192 R193
BS02	ADP	B	G263 V268 A281 K283 I332 E333 V335 D339 D382 L385 D396 F552	G15 V20 A33 K35 I75 E76 V78 D82 D125 L128 D139 F284
BS03	AF3	B	R377 Y419 V434	R120 Y162 V177
BS04	MN	B	N383 D396	N126 D139
BS05	AF3	B	G263 S264 D396	G15 S16 D139

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004674 protein serine/threonine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation
• GO:0007163 establishment or maintenance of cell polarity

External links

• PDB: RCSB:5lih, PDBe:5lih, PDBj:5lih
• PDBsum: 5lih
• PubMed: 27554858
• UniProt: P41743|KPCI_HUMAN Protein kinase C iota type (Gene Name=PRKCI)