Structure of PDB 5lfg Chain B

Receptor sequence

>5lfgB (length=146) Species: 35730 (Trematomus newnesi)

VEWTDKERSIISDIFSHMDYDDIGPKALSRCLVVYPWTQRYFSGFGNLYN
AEGIMSNANVAAHGIKVLHGLDRGMKNMDNIADAYTDLSTLHSEKLHVDP
DNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAAVVSALGKQYH

3D structure

• PDB: 5lfg Fine Sampling of the RT Quaternary-Structure Transition of a Tetrameric Hemoglobin.
• Chain: B
• Resolution: 1.94 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	T38 Y41 F42 F45 H63 K66 V67 H92 L96 V98 N102 F103 L141	T38 Y41 F42 F45 H63 K66 V67 H92 L96 V98 N102 F103 L141

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:5lfg, PDBe:5lfg, PDBj:5lfg
• PDBsum: 5lfg
• PubMed: 27808442
• UniProt: P45720|HBB_TRENE Hemoglobin subunit beta-1/2