Structure of PDB 5lcl Chain B

Receptor sequence

>5lclB (length=114) Species: 559292 (Saccharomyces cerevisiae S288C)

APKCIECHINIEMDPVLHDVFKLQVCKQCSKEHPEKYALLTKTECKEDYF
LTDPELNDEDLFHRLEKPNPHSGTFARMQLFVRCEVEAFAFKKWGGEEGL
DEEWQRREEGKAHR

3D structure

• PDB: 5lcl Structural Insights into the Recognition of N(2) -Aryl- and C8-Aryl DNA Lesions by the Repair Protein XPA/Rad14.
• Chain: B
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	T228 K229 T230 E231 E234 N256 H258 A263 R264 M265 Q266	T41 K42 T43 E44 E47 N69 H71 A76 R77 M78 Q79
BS02	ZN	B	C191 C194 C213 C216	C4 C7 C26 C29

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000715 nucleotide-excision repair, DNA damage recognition
• GO:0006281 DNA repair
• GO:0006284 base-excision repair
• GO:0006289 nucleotide-excision repair
• GO:0006974 DNA damage response
• GO:0070914 UV-damage excision repair
• GO:1901255 nucleotide-excision repair involved in interstrand cross-link repair

Cellular Component

• GO:0000110 nucleotide-excision repair factor 1 complex
• GO:0005634 nucleus

External links

• PDB: RCSB:5lcl, PDBe:5lcl, PDBj:5lcl
• PDBsum: 5lcl
• PubMed: 28444956
• UniProt: P28519|RAD14_YEAST DNA repair protein RAD14 (Gene Name=RAD14)