Structure of PDB 5l9b Chain B

Receptor sequence

>5l9bB (length=218) Species: 9606 (Homo sapiens)

LPALKLALEYIVPAMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTD
GQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKL
GSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAK
VSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAIT
VWYFDADERAAAKVKYLT

3D structure

• PDB: 5l9b Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
• Chain: B
• Resolution: 1.95 Å

Enzymatic activity

• Enzyme Commision number: 1.14.11.29: hypoxia-inducible factor-proline dioxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	Q239 L240 V241 S242 K244 R252 W258 N293 G294 R295 K297 Y310 H313 V314 D315 P317 R322 R370 W389 F391 R396 K400	Q52 L53 V54 S55 K57 R65 W71 N106 G107 R108 K110 Y123 H126 V127 D128 P130 R135 R183 W202 F204 R209 K213
BS02	MN	B	H313 D315 H374	H126 D128 H187
BS03	AKG	B	Y310 H313 Y329 H374 V376 R383	Y123 H126 Y142 H187 V189 R196

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0031418 L-ascorbic acid binding

External links

• PDB: RCSB:5l9b, PDBe:5l9b, PDBj:5l9b
• PDBsum: 5l9b
• PubMed: 27561929
• UniProt: Q9GZT9|EGLN1_HUMAN Egl nine homolog 1 (Gene Name=EGLN1)