Structure of PDB 5l2l Chain B

Receptor sequence

>5l2lB (length=74) Species: 1294386 (Saccharomyces cerevisiae YJM1574) [Search protein sequence]

GSEKSLEQCKFGTHCTNKRCKYRHARSHIMCREGANCTRIDCLFGHPINE
DCRFGVNCKNIYCLFRHPPGRVLP

3D structure

PDB

5l2l Structural basis for the dimerization of Nab2 generated by RNA binding provides insight into its contribution to both poly(A) tail length determination and transcript compaction in Saccharomyces cerevisiae.

Chain

Resolution

1.55 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	B	T419 R432 I435 C437 R438 R445 L449 F450	T13 R26 I29 C31 R32 R39 L43 F44
BS02	rna	B	K416 F417 C421 T422 E456 R459 F460 F471	K10 F11 C15 T16 E50 R53 F54 F65
BS03	rna	B	C415 F417 N423 K424 R425 Y428	C9 F11 N17 K18 R19 Y22
BS04	ZN	B	C415 C421 C426 H430	C9 C15 C20 H24
BS05	ZN	B	C437 C443 C448 H452	C31 C37 C42 H46
BS06	ZN	B	C458 C464 C469 H473	C52 C58 C63 H67

External links

PDB	RCSB:5l2l, PDBe:5l2l, PDBj:5l2l
PDBsum	5l2l
PubMed	28180315
UniProt	P32505\|NAB2_YEAST Nuclear polyadenylated RNA-binding protein NAB2 (Gene Name=NAB2)

[Back to BioLiP]