Structure of PDB 5ktu Chain B |
>5ktuB (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] |
IFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPM DLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAE VFEQEIDPVMQSL |
|
PDB | 5ktu Discovery of a Potent and Selective in Vivo Probe (GNE-272) for the Bromodomains of CBP/EP300. |
Chain | B |
Resolution | 1.38 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
6XB |
B |
L1109 R1112 |
L26 R29 |
BindingDB: IC50=620nM |
|
|
|