Structure of PDB 5kp8 Chain B |
>5kp8B (length=78) Species: 158786 (Lyngbya majuscula) [Search protein sequence] |
MSKEQVLKIIKKYTREIAPELEDSPLEPTDSLKKLGIDSVNRAEIIMMVM EDLSLNIPRIELAGAKNIGELADLFAAK |
|
PDB | 5kp8 Anatomy of the beta-branching enzyme of polyketide biosynthesis and its interaction with an acyl-ACP substrate. |
Chain | B |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
6VG |
B |
D38 S39 |
D38 S39 |
|
|
|