Structure of PDB 5knp Chain B

Receptor sequence

>5knpB (length=175) Species: 83332 (Mycobacterium tuberculosis H37Rv)

LYPGDIKSVLLTAEQIQARIAELGEQIGNDYRATTGQDLLLITVLKGAVL
FVTDLARAIPVPTQFEFMAVSSYGGVVRILKDLDRDIHGRDVLIVEDVVD
SGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFV
VGYGLDYDERYRDLSYIGTLDPRVY

3D structure

• PDB: 5knp Crystal structure of Mycobacterium tuberculosis hypoxanthine guanine phosphoribosyltransferase in complex with pyrrolidine nucleoside phosphonate
• Chain: B
• Resolution: 2.45 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E122 D123 D126 F175 R188
• Catalytic site (residue number reindexed from 1): E96 D97 D100 F149 R162
• Enzyme Commision number: 2.4.2.8: hypoxanthine phosphoribosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	6W7	B	V125 D126 S127 G128 K154 F175 V176	V99 D100 S101 G102 K128 F149 V150
BS02	MG	B	E122 D123	E96 D97
BS03	POP	B	L65 K66 G67 R188	L45 K46 G47 R162

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0000287 magnesium ion binding
• GO:0004422 hypoxanthine phosphoribosyltransferase activity
• GO:0016757 glycosyltransferase activity
• GO:0046872 metal ion binding
• GO:0052657 guanine phosphoribosyltransferase activity

Biological Process

• GO:0006166 purine ribonucleoside salvage
• GO:0006177 GMP biosynthetic process
• GO:0006178 guanine salvage
• GO:0006188 IMP biosynthetic process
• GO:0032263 GMP salvage
• GO:0032264 IMP salvage
• GO:0043101 purine-containing compound salvage
• GO:0046100 hypoxanthine metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:5knp, PDBe:5knp, PDBj:5knp
• PDBsum: 5knp
• UniProt: P9WHQ9|HGPRT_MYCTU Hypoxanthine-guanine phosphoribosyltransferase (Gene Name=hpt)