Structure of PDB 5kl1 Chain B

Receptor sequence
>5kl1B (length=70) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
SRHCVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAH
TIKYCPKKPIITMEDAIKAE
3D structure
PDB5kl1 Drosophila Nanos acts as a molecular clamp that modulates the RNA-binding and repression activities of Pumilio.
ChainB
Resolution3.701 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B V320 F321 N324 N325 L349 Y352 H365 T366 I367 K368 Y369 V5 F6 N9 N10 L34 Y37 H50 T51 I52 K53 Y54 PDBbind-CN: Kd=8.7nM
BS02 ZN B C319 C322 H335 C346 C4 C7 H20 C31
BS03 ZN B C354 C357 H365 C370 C39 C42 H50 C55
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:5kl1, PDBe:5kl1, PDBj:5kl1
PDBsum5kl1
PubMed27482653
UniProtP25724|NANOS_DROME Protein nanos (Gene Name=nanos)

[Back to BioLiP]