Structure of PDB 5kap Chain B

Receptor sequence

>5kapB (length=170) Species: 5702 (Trypanosoma brucei brucei)

YDFATSVLFTEAELHTRMRGVAQRIADDYSNCNLKPLENPLVIVSVLKGS
FVFTADMVRILGDFGVPTRVEFLRCDIRGKHVLVLEDILDTALTLREVVD
SLKKSEPASIKTLVAIDKPGGRKIPFTAEYVVADVPNVFVVGYGLDYDQS
YREVRDVVILKPSVYETWGK

3D structure

• PDB: 5kap Crystal structures and inhibition of Trypanosoma brucei hypoxanthine-guanine phosphoribosyltransferase.
• Chain: B
• Resolution: 2.95 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E113 D114 D117 F166 R179
• Catalytic site (residue number reindexed from 1): E86 D87 D90 F139 R152
• Enzyme Commision number: 2.4.2.8: hypoxanthine phosphoribosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	6RH	B	I115 V167	I88 V140
BS02	MG	B	E113 D114	E86 D87
BS03	MG	B	Q176 S177	Q149 S150

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0000287 magnesium ion binding
• GO:0004422 hypoxanthine phosphoribosyltransferase activity
• GO:0016757 glycosyltransferase activity
• GO:0046872 metal ion binding
• GO:0052657 guanine phosphoribosyltransferase activity

Biological Process

• GO:0006166 purine ribonucleoside salvage
• GO:0006178 guanine salvage
• GO:0032263 GMP salvage
• GO:0032264 IMP salvage
• GO:0046100 hypoxanthine metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0020015 glycosome
• GO:0031981 nuclear lumen
• GO:0097014 ciliary plasm

External links

• PDB: RCSB:5kap, PDBe:5kap, PDBj:5kap
• PDBsum: 5kap
• PubMed: 27786284
• UniProt: Q07010|HPRT_TRYBB Hypoxanthine-guanine phosphoribosyltransferase (Gene Name=HGPRT)