Structure of PDB 5k7x Chain B

Receptor sequence

>5k7xB (length=337) Species: 70601 (Pyrococcus horikoshii OT3)

PSVIVVGGQWGDEGKGSIVAYLSLHDEPEIIARGGVGTNAGHSVVINGKK
YAVRQIPTGFMQTKARLLIGAGVLVDPEVFFHELEQLKDFNVKDRVGIDY
RCAIIEEKHKQLDRTNGYLHGKIGTTGSGCGPANADRVMRKAKQAKDVKE
LEPYLTDVAQEINDALDEGSLVLVEGTQGFGLSLYYGTYPYVTSKDVTAS
SVAADVGIGPTRVDEVIVVFKSFPTRVGAGPFPTEMPMEEADRLGLVEYG
TVTGRRRRVGWFDFEMARYSARINGATMLAVTMLDKYDKEAFGVTDYDKL
PRKAKEFIEEIEERVGVPVGLIKTGPELEHIIDRRDT

3D structure

• PDB: 5k7x Crystal structure of hypothetical adenylosuccinate synthetase, PH0438 from Pyrococcus horikoshii OT3
• Chain: B
• Resolution: 2.803 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D13 K16 G42 H43 Q179
• Catalytic site (residue number reindexed from 1): D12 K15 G41 H42 Q178
• Enzyme Commision number: 6.3.4.4: adenylosuccinate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	B	D13 E14 G15 K16 S18 G42 H43 S44 R258 M284 D286 K324 G326 P327	D12 E13 G14 K15 S17 G41 H42 S43 R257 M283 D285 K323 G325 P326
BS02	IMP	B	D13 N40 T126 T127 Q179 L183 T194 V228	D12 N39 T125 T126 Q178 L182 T193 V227
BS03	HDA	B	D13 G251 T252 V253 T254	D12 G250 T251 V252 T253
BS04	MG	B	D13 G42	D12 G41

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0000287 magnesium ion binding
• GO:0004019 adenylosuccinate synthase activity
• GO:0005525 GTP binding
• GO:0016874 ligase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006164 purine nucleotide biosynthetic process
• GO:0044208 'de novo' AMP biosynthetic process
• GO:0046040 IMP metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5k7x, PDBe:5k7x, PDBj:5k7x
• PDBsum: 5k7x
• UniProt: O58187|PURA_PYRHO Adenylosuccinate synthetase (Gene Name=purA)