Structure of PDB 5jph Chain B

Receptor sequence
>5jphB (length=144) Species: 93062 (Staphylococcus aureus subsp. aureus COL) [Search protein sequence]
SNAMFSKVNNQKMLEDCFYIRKKVFVEEQGIPEESEIDEYESESIHLIGY
DNGQPVATARIRPINETTVKIERVAVMKSHRGQGMGRMLMQAVESLAKDE
GFYVATMNAQCHAIPFYESLNFKMRGNIFLEEGIEHIEMTKKLT
3D structure
PDB5jph Insight into the 3D structure and substrate specificity of previously uncharacterized GNAT superfamily acetyltransferases from pathogenic bacteria.
ChainB
Resolution1.46 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 COA B F22 I28 D35 Y37 R59 E69 R70 V71 M104 N105 E128 E129 F25 I31 D38 Y40 R62 E72 R73 V74 M107 N108 E131 E132
BS02 COA B V21 Q26 V71 A72 V73 R78 G79 G81 G83 R84 Q107 H109 F113 Y114 V24 Q29 V74 A75 V76 R81 G82 G84 G86 R87 Q110 H112 F116 Y117
Gene Ontology
Molecular Function
GO:0008080 N-acetyltransferase activity
GO:0016746 acyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups

View graph for
Molecular Function
External links
PDB RCSB:5jph, PDBe:5jph, PDBj:5jph
PDBsum5jph
PubMed27783928
UniProtQ5HH30|ATSE_STAAC Acetyltransferase SACOL1063 (Gene Name=SACOL1063)

[Back to BioLiP]