Structure of PDB 5jpg Chain B

Receptor sequence

>5jpgB (length=135) Species: 10116 (Rattus norvegicus)

PNLAVPFFTSIPNGLYPSKSIVISGVVLSDAKRFQINLRCGGDIAFHLNP
RFDENAVVRNTQINNSWGPEERSLPGSMPFSRGQRFSVWILCEGHCFKVA
VDGQHICEYSHRLMNLPDINTLEVAGDIQLTHVET

3D structure

• PDB: 5jpg Structural Characterization of Rat Galectin-5, an N-Tailed Monomeric Proto-Type-like Galectin.
• Chain: B
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GLC	B	R61 E80	R51 E70
BS02	GAL	B	H57 R61 W77 E80	H47 R51 W67 E70

Gene Ontology

Molecular Function

• GO:0016936 galactoside binding
• GO:0030246 carbohydrate binding
• GO:0030395 lactose binding

Biological Process

• GO:0010628 positive regulation of gene expression
• GO:0032689 negative regulation of type II interferon production
• GO:0070234 positive regulation of T cell apoptotic process
• GO:2000562 negative regulation of CD4-positive, alpha-beta T cell proliferation

Cellular Component

• GO:0005634 nucleus
• GO:0005829 cytosol

External links

• PDB: RCSB:5jpg, PDBe:5jpg, PDBj:5jpg
• PDBsum: 5jpg
• PubMed: 34944498
• UniProt: P47967|LEG5_RAT Galectin-5 (Gene Name=Lgals5)