Structure of PDB 5jk0 Chain B

Receptor sequence

>5jk0B (length=345) Species: 85962 (Helicobacter pylori 26695)

MKHPLEELKDPTENLLLWIGRFLRYKCTSLSNSQVKDQNKVFECLNELNQ
ACSSSQLEKVCKKARNAGLLGINTYALPLLKFHEYFSKARLITFNSLKNI
DEVMLAEFLSVYTGGLSLATKKNYRIALLGLFSYIDKQNQDENEKSYIYN
ITLKKLPTHLNNEELEKFLESIDKIEMSAKVRARNRLLIKIIVFTGMRSN
EALQLKIKDFTLENGCYTILIKGKGDKYRAVMLKAFHIESLLKEWLIERE
LYPVKNDLLFCNQKGSALTQAYLYKQVERIINFAGLRREKNGAHMLRHSF
ATLLYQKRHDLILVQEALGHASLNTSRIYTHFDKQRLEEAASIWE

3D structure

• PDB: 5jk0 Structural snapshots of Xer recombination reveal activation by synaptic complex remodeling and DNA bending.
• Chain: B
• Resolution: 2.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	K62 R65 N66 L77 L120 S121 T124 N127 S193 R199 R213 N277 L283 T284 A286 Y287 K305 H309 H335 A336	K62 R65 N66 L77 L116 S117 T120 N123 S178 R184 R198 N262 L268 T269 A271 Y272 K290 H294 H320 A321	PDBbind-CN: Kd=150nM
BS02	dna	B	K26 L30 S31 L70 G71 N73 T74 Y75 K126 R129 K158 S214 N215 Q285 Y289 G307 H309	K26 L30 S31 L70 G71 N73 T74 Y75 K122 R125 K154 S199 N200 Q270 Y274 G292 H294	PDBbind-CN: Kd=150nM

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0009037 tyrosine-based site-specific recombinase activity

Biological Process

• GO:0006310 DNA recombination
• GO:0007059 chromosome segregation
• GO:0015074 DNA integration
• GO:0051301 cell division

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5jk0, PDBe:5jk0, PDBj:5jk0
• PDBsum: 5jk0
• PubMed: 28009253
• UniProt: O25386|XERH_HELPY Tyrosine recombinase XerH (Gene Name=xerH)