Structure of PDB 5jhn Chain B

Receptor sequence

>5jhnB (length=267) Species: 9606 (Homo sapiens)

EKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNI
THLQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECN
QACSCWRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYV
GELISDAEADVREDDSYLFDLDEVYCIDARYYGNISRFINHLCDPNIIPV
RVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQCGS
EKCKHSAEAIALEQSRL

3D structure

• PDB: 5jhn S-adenosyl methionine is necessary for inhibition of the methyltransferase G9a by the lysine 9 to methionine mutation on histone H3.
• Chain: B
• Resolution: 1.67 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y1067 Y1154
• Catalytic site (residue number reindexed from 1): Y149 Y232
• Enzyme Commision number: 2.1.1.-
  2.1.1.367: [histone H3]-lysine(9) N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	D1074 A1077 D1078 D1083 L1086 F1087 D1088 R1123 Y1154 R1157 F1158 I1161	D156 A159 D160 D165 L168 F169 D170 R201 Y232 R235 F236 I239
BS02	ZN	B	C974 C987 C1017 C1021	C56 C69 C99 C103
BS03	ZN	B	C980 C1017 C1023 C1027	C62 C99 C105 C109
BS04	ZN	B	C974 C976 C980 C985	C56 C58 C62 C67
BS05	ZN	B	C1115 C1168 C1170 C1175	C193 C246 C248 C253
BS06	SAM	B	M1048 W1050 S1084 Y1085 R1109 F1110 N1112 H1113 Y1154 F1166 C1168 Q1169	M130 W132 S166 Y167 R187 F188 N190 H191 Y232 F244 C246 Q247

Gene Ontology

Molecular Function

• GO:0002039 p53 binding
• GO:0008270 zinc ion binding
• GO:0016279 protein-lysine N-methyltransferase activity
• GO:0042054 histone methyltransferase activity

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:5jhn, PDBe:5jhn, PDBj:5jhn
• PDBsum: 5jhn
• PubMed: 27185940
• UniProt: Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 (Gene Name=EHMT2)