Structure of PDB 5jea Chain B

Receptor sequence

>5jeaB (length=243) Species: 559292 (Saccharomyces cerevisiae S288C)

RLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITL
VKGPKEPRLKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQT
SLVRMFEKNVMLNIYPRTVIDIEIHVLEQDGGIMGSLINGITLALIDAGI
SMFDYISGISVGLYDTTPLLDTNSLEENAMSTVTLGVVGKSEKLSLLLVE
DKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRVSNASA

3D structure

• PDB: 5jea Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
• Chain: B
• Resolution: 2.65 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	L14 R119	L12 R117

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003723 RNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000956 nuclear-transcribed mRNA catabolic process
• GO:0006364 rRNA processing
• GO:0006396 RNA processing
• GO:0006401 RNA catabolic process
• GO:0016075 rRNA catabolic process
• GO:0034473 U1 snRNA 3'-end processing
• GO:0034475 U4 snRNA 3'-end processing
• GO:0034476 U5 snRNA 3'-end processing
• GO:0070478 nuclear-transcribed mRNA catabolic process, 3'-5' exonucleolytic nonsense-mediated decay
• GO:0071028 nuclear mRNA surveillance
• GO:0071038 TRAMP-dependent tRNA surveillance pathway
• GO:0071039 nuclear polyadenylation-dependent CUT catabolic process
• GO:0071051 poly(A)-dependent snoRNA 3'-end processing

Cellular Component

• GO:0000176 nuclear exosome (RNase complex)
• GO:0000177 cytoplasmic exosome (RNase complex)
• GO:0000178 exosome (RNase complex)
• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:5jea, PDBe:5jea, PDBj:5jea
• PDBsum: 5jea
• PubMed: 27345150
• UniProt: P46948|RRP41_YEAST Exosome complex component SKI6 (Gene Name=SKI6)