Structure of PDB 5jdj Chain B |
>5jdjB (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] |
GAMETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEK FKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVT |
|
PDB | 5jdj Exploration of pathomechanisms triggered by a single-nucleotide polymorphism in titin's I-band: the cardiomyopathy-linked mutation T2580I. |
Chain | B |
Resolution | 1.738 Å |
3D structure |
|
|
Enzyme Commision number |
2.7.11.1: non-specific serine/threonine protein kinase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
S24 E26 |
S24 E26 |
|
|
|