Structure of PDB 5j8o Chain B |
>5j8oB (length=124) Species: 9606 (Homo sapiens) [Search protein sequence] |
AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQF VHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMIS YGGADYKRITVKVNAPYAAALEHH |
|
PDB | 5j8o Structural basis for small molecule targeting of the programmed death ligand 1 (PD-L1). |
Chain | B |
Resolution | 2.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
6GZ |
B |
Y56 M115 A121 D122 |
Y39 M98 A104 D105 |
BindingDB: IC50=146nM |
|
|