Structure of PDB 5ie9 Chain B |
>5ie9B (length=94) Species: 1396 (Bacillus cereus) [Search protein sequence] |
MEAKTMKDMQKEVDAYIGQFKEGYFSPLAMMARLTEEMGELAREVNHYYG ERSIEEELGDVLFVMICMANSLNIDLETAHNIVMNKFNTRDKDR |
|
PDB | 5ie9 Crystal structure of the Bacillus-conserved MazG protein, a nucleotide pyrophosphohydrolase. |
Chain | B |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
B |
E37 E40 E66 D69 |
E37 E40 E57 D60 |
|
|
|
|