Structure of PDB 5i2e Chain B |
>5i2eB (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] |
DTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISV AEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHV LGGRQMHWPPG |
|
PDB | 5i2e Design, Synthesis, and Characterization of Sulfamide and Sulfamate Nucleotidomimetic Inhibitors of hHint1. |
Chain | B |
Resolution | 1.6 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
67D |
B |
M121 H122 W123 |
M106 H107 W108 |
PDBbind-CN: -logKd/Ki=6.64,Kd=0.23uM |
|
|
|