Structure of PDB 5hz9 Chain B

Receptor sequence

>5hz9B (length=135) Species: 9606 (Homo sapiens) [Search protein sequence]

SHMVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGD
ILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKW
DGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

3D structure

PDB

5hz9 Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors.

Chain

Resolution

2.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	5M8	B	F17 M21 P39 T54 S56 F58 A76 D77	F19 M23 P41 T56 S58 F60 A78 D79	MOAD: Ki=0.093uM BindingDB: Ki=93nM
BS02	5M8	B	G25 G27 F28 R31	G27 G29 F30 R33	MOAD: Ki=0.093uM BindingDB: Ki=93nM

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0008092	cytoskeletal protein binding
GO:0008289	lipid binding
GO:0036041	long-chain fatty acid binding
GO:0070538	oleic acid binding

	Biological Process
GO:0008285	negative regulation of cell population proliferation
GO:0015909	long-chain fatty acid transport
GO:0032365	intracellular lipid transport
GO:0042632	cholesterol homeostasis
GO:0046320	regulation of fatty acid oxidation
GO:0050873	brown fat cell differentiation
GO:0055091	phospholipid homeostasis
GO:0071073	positive regulation of phospholipid biosynthetic process
GO:0140214	positive regulation of long-chain fatty acid import into cell
GO:2001245	regulation of phosphatidylcholine biosynthetic process

External links

PDB	RCSB:5hz9, PDBe:5hz9, PDBj:5hz9
PDBsum	5hz9
PubMed	27658368
UniProt	P05413\|FABPH_HUMAN Fatty acid-binding protein, heart (Gene Name=FABP3)