Structure of PDB 5hrk Chain B

Receptor sequence
>5hrkB (length=176) Species: 10497 (African swine fever virus) [Search protein sequence]
GGMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLN
DVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQ
LDLFTALAEEKPYAIFFFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTL
VPLKITTEKELIKELGFTYRIPKKRL
3D structure
PDB5hrk The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
ChainB
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.7.7: DNA-directed DNA polymerase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B V80 C81 G82 E83 R84 K85 R127 N138 Q139 Y140 V82 C83 G84 E85 R86 K87 R129 N140 Q141 Y142
BS02 dna B R125 T166 R168 R127 T168 R170
BS03 DGT B G38 S39 R42 N48 D49 D51 F116 T117 G118 V120 G40 S41 R44 N50 D51 D53 F118 T119 G120 V122
BS04 MN B D49 D51 D51 D53
BS05 MN B D49 D51 D100 D51 D53 D102
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003887 DNA-directed DNA polymerase activity
GO:0016779 nucleotidyltransferase activity
GO:0046872 metal ion binding
Biological Process
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006303 double-strand break repair via nonhomologous end joining
GO:0071897 DNA biosynthetic process
Cellular Component
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5hrk, PDBe:5hrk, PDBj:5hrk
PDBsum5hrk
PubMed
UniProtP42494|DPOLX_ASFB7 Repair DNA polymerase X (Gene Name=Ba71V-97)

[Back to BioLiP]