Structure of PDB 5hrh Chain B

Receptor sequence

>5hrhB (length=176) Species: 10497 (African swine fever virus)

GGMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLN
DVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQ
LDLFTALAEEKPYAIFFFTGPVSYLIRIAAALKKKNYKLNQYGLFKNQTL
VPLKITTEKELIKELGFTYRIPKKRL

3D structure

• PDB: 5hrh The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
• Chain: B
• Resolution: 3.0 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	V80 C81 G82 R84 K85 L123 A127 K131 K136 N138 Q139 Y140	V82 C83 G84 R86 K87 L125 A129 K133 K138 N140 Q141 Y142
BS02	dna	B	R125 F165 T166 R168	R127 F167 T168 R170
BS03	DGT	B	G38 S39 R42 N48 D49 D51 F115 F116 T117 V120 L123	G40 S41 R44 N50 D51 D53 F117 F118 T119 V122 L125
BS04	MN	B	S39 D49 D51	S41 D51 D53
BS05	MN	B	D49 D51 D100	D51 D53 D102

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006259 DNA metabolic process
• GO:0006281 DNA repair
• GO:0006303 double-strand break repair via nonhomologous end joining
• GO:0071897 DNA biosynthetic process

Cellular Component

• GO:0044423 virion component

External links

• PDB: RCSB:5hrh, PDBe:5hrh, PDBj:5hrh
• PDBsum: 5hrh
• UniProt: P42494|DPOLX_ASFB7 Repair DNA polymerase X (Gene Name=Ba71V-97)