Structure of PDB 5hk1 Chain B

Receptor sequence

>5hk1B (length=219) Species: 9606 (Homo sapiens) [Search protein sequence]

MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYA
GLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASL
SEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGE
TVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLF
YTLRSYARGLRLELTTYLF

3D structure

PDB

5hk1 Crystal structure of the human sigma 1 receptor.

Chain

Resolution

2.5051 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	61W	B	L105 F107 Y120 H154 E172 I178 L182 Y206	L105 F107 Y120 H154 E172 I178 L182 Y206	BindingDB: Ki=2.0nM

Gene Ontology

	Molecular Function
GO:0004985	G protein-coupled opioid receptor activity
GO:0005515	protein binding
GO:0038023	signaling receptor activity

	Biological Process
GO:0006869	lipid transport
GO:0007399	nervous system development
GO:0038003	G protein-coupled opioid receptor signaling pathway
GO:0043523	regulation of neuron apoptotic process
GO:0070207	protein homotrimerization
GO:0150052	regulation of postsynapse assembly

	Cellular Component
GO:0005634	nucleus
GO:0005635	nuclear envelope
GO:0005637	nuclear inner membrane
GO:0005640	nuclear outer membrane
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0005811	lipid droplet
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0014069	postsynaptic density
GO:0016020	membrane
GO:0030426	growth cone
GO:0031410	cytoplasmic vesicle
GO:0042995	cell projection
GO:0045202	synapse
GO:0045211	postsynaptic membrane
GO:0070161	anchoring junction
GO:0098794	postsynapse
GO:0098839	postsynaptic density membrane
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5hk1, PDBe:5hk1, PDBj:5hk1
PDBsum	5hk1
PubMed	27042935
UniProt	Q99720\|SGMR1_HUMAN Sigma non-opioid intracellular receptor 1 (Gene Name=SIGMAR1)

[Back to BioLiP]