Structure of PDB 5h3r Chain B

Receptor sequence
>5h3rB (length=140) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
SDLFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAAC
ITPVELKKVLSVDLGALTRMLDRLVSKGWVERLPNPNDKRGVLVKLTTGG
AAICEQCHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP
3D structure
PDB5h3r Structural characterization of the DNA-binding mechanism underlying the copper(II)-sensing MarR transcriptional regulator.
ChainB
Resolution2.67 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B P57 V58 L68 G69 R73 R94 G95 V96 P53 V54 L64 G65 R69 R90 G91 V92
BS02 dna B T39 Q42 V66 D67 R73 M74 R77 K93 R94 T35 Q38 V62 D63 R69 M70 R73 K89 R90
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress
GO:0009408 response to heat
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic
GO:0071236 cellular response to antibiotic

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5h3r, PDBe:5h3r, PDBj:5h3r
PDBsum5h3r
PubMed28124121
UniProtP27245|MARR_ECOLI Multiple antibiotic resistance protein MarR (Gene Name=marR)

[Back to BioLiP]