Structure of PDB 5g5g Chain B

Receptor sequence

>5g5gB (length=316) Species: 83333 (Escherichia coli K-12)

MKAFTYERVNTPAEAALSAQRVPGAKFIAGGTNLLDLMKLEIETPTHLID
VNGLGLDKIEVTDAGGLRIGALVRNTDLAAHERVRRDYAVLSRALLAGAS
GQLRNQATTAGNLLQRTRCPYFYDTNQPCNKRLPGSGCAALEGFSRQHAV
VGVSEACIATHPSDMAVAMRLLDAVVETITPEGKTRSITLADFYHPPGKT
PHIETALLPGELIVAVTLPPPLGGKHIYRKVRDRASYAFALVSVAAIIQP
DGSGRVALGGVAHKPWRIEAADAQLSQGAQAVYDTLFASAHPTAENTFKL
LLAKRTLASVLAEARA

3D structure

• PDB: 5g5g The Escherichia Coli Periplasmic Aldehyde Oxidoreductase is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes.
• Chain: B
• Resolution: 1.7 Å

Enzymatic activity

• Enzyme Commision number: 1.2.99.6: carboxylate reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	B	C119 C129 N130 K131 C138 H148 C157 I158 A159	C119 C129 N130 K131 C138 H148 C157 I158 A159
BS02	FAD	B	K26 F27 A29 G30 G31 T32 N33 L34 G98 A99 L103 A107 T108 A110 G111 N112 L114 Q115 S163 D164 L212 I213 F239	K26 F27 A29 G30 G31 T32 N33 L34 G98 A99 L103 A107 T108 A110 G111 N112 L114 Q115 S163 D164 L212 I213 F239

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0016903 oxidoreductase activity, acting on the aldehyde or oxo group of donors
• GO:0046872 metal ion binding
• GO:0047770 carboxylate reductase activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0051539 4 iron, 4 sulfur cluster binding
• GO:0071949 FAD binding

Biological Process

• GO:0009056 catabolic process
• GO:0110095 cellular detoxification of aldehyde

Cellular Component

• GO:0030288 outer membrane-bounded periplasmic space
• GO:0042597 periplasmic space
• GO:1990204 oxidoreductase complex

External links

• PDB: RCSB:5g5g, PDBe:5g5g, PDBj:5g5g
• PDBsum: 5g5g
• PubMed: 27622978
• UniProt: P77324|PAOB_ECOLI Aldehyde oxidoreductase FAD-binding subunit PaoB (Gene Name=paoB)